CD80, also known as the B-cell activation antigen B7-1, is a single-pass type I transmemebrane glycoprotein that belongs to the B7 family of the Ig superfamily.  Like other B7 family members, CD80 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the B7 family members, they share about 20-25% amino acid identity. CD80 is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. CD80 provides a co-stimulatory signal necessary for T cell activation and survival. CD80 is the ligand for two different receptors on the T cell surface: CD28 and CTLA-4 (also known as CD152). CD80 works in concert with CD86 (also known as B7-2) to prime T cells. CD80 and CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses, tolerance and the generation of CTL.  The binding of CD80:CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. CD80 also binds to B7 family ligand PD-L1 to regulate immune cell activation.  CD80 may act as a receptor for adenovirus subgroup B and play a role in lupus neuropathy.  CD80 is regarded as a promising therapeutic target for autoimmune diseases and cancer. Human CD80 and CD86 share 26% amino acid identity, while human and mouse CD80 share 44% amino acid identity. It has been reported that both human and mouse CD80 and CD86 can bind to either human or mouse CD28 and CTLA4. Human CD80 also interacts with human and mouse PD-L1/B7-H1.

CD80, also known as the B-cell activation antigen B7-1, is a single-pass type I transmemebrane glycoprotein that belongs to the B7 family of the Ig superfamily.  Like other B7 family members, CD80 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the B7 family members, they share about 20-25% amino acid identity. CD80 is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. CD80 provides a co-stimulatory signal necessary for T cell activation and survival. CD80 is the ligand for two different receptors on the T cell surface: CD28 and CTLA-4 (also known as CD152). CD80 works in concert with CD86 (also known as B7-2) to prime T cells. CD80 and CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses, tolerance and the generation of CTL.  The binding of CD80:CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. CD80 also binds to B7 family ligand PD-L1 to regulate immune cell activation.  CD80 may act as a receptor for adenovirus subgroup B and play a role in lupus neuropathy.  CD80 is regarded as a promising therapeutic target for autoimmune diseases and cancer. Human CD80 and CD86 share 26% amino acid identity, while human and mouse CD80 share 44% amino acid identity. It has been reported that both human and mouse CD80 and CD86 can bind to either human or mouse CD28 and CTLA4. Human CD80 also interacts with human and mouse PD-L1/B7-H1.

 

Product Details

 

Gene Symbol: CD80; B7-1; B7.1; BB1; BB-1; B7; CD28LG; CD28LG1; LAB7

 

NCBI Gene ID: 941

 

Uniprot Entry: P33681

 

Construct Details: The recombinant human CD80 ECD protein is expressed as a 220 amino acid protein consisting of Val35 - Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.

 

Source:  Human cells stably expressing CD80 ECD and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRP

SDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEEL

NAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGHHHHHHHH

 

M.W.:  Calculated molecular mass 25.3 kDa; estimated by SDS-PAGE under reducing condition 45-55 kDa probably due to glycosylation

 

Calculated PI: 6.27

 

Calculated Extinction Coefficients (M-1 cm-1, at 280nm): 31190

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds human CD28, CTLA4 and PD-L1.  Induces IL-2 secretion in human T cells.

  

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Exp. Med. 174:625 (1991). 

2. Nature 366:76 (1993).  

3. Science 262:909 (1993).  

4. J. Immunol. 152:4929 (1994).  

5. Annu. Rev. Immunol. 23:515 (2005).  

 

 

 

 

 FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0716-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.