SLAMF3 (signaling lymphocytic activation molecule family member 3), also known as Ly9 and CD229, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF3 contains 2 Ig-like V-type and 2 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region.  SLAMF3 is expressed on lymphocytes, thymocytes, and more weakly on NK cells. SLAMF3 cell surface expression on lymphocytes surface is differentially regulated within the SLAM family members. SLAMF3 is a pan-lymphocyte marker and antibodies against it are able to down-regulate T-cell activation. Homophilic interactions between SLAMF3 are mediated through its Ig­like domains and involved in the immunological synapse. Antigen stimulation of lymphocytes induces SLAMF3 clustering to the sites of T cell and B cell contact. Two tyrosines in the cytoplasmic domain are required for association with adaptor proteins and internalization. It has been reported that human and mouse SLAMF3 show cross­species binding.

SLAMF3 (signaling lymphocytic activation molecule family member 3), also known as Ly9 and CD229, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF3 contains 2 Ig-like V-type and 2 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region.  SLAMF3 is expressed on lymphocytes, thymocytes, and more weakly on NK cells. SLAMF3 cell surface expression on lymphocytes surface is differentially regulated within the SLAM family members. SLAMF3 is a pan-lymphocyte marker and antibodies against it are able to down-regulate T-cell activation. Homophilic interactions between SLAMF3 are mediated through its Ig­like domains and involved in the immunological synapse. Antigen stimulation of lymphocytes induces SLAMF3 clustering to the sites of T cell and B cell contact. Two tyrosines in the cytoplasmic domain are required for association with adaptor proteins and internalization. It has been reported that human and mouse SLAMF3 show cross­species binding.

 

Product Details

 

Gene Symbol: SLAMF3; CD229; Ly9; hly9; mLY9; Ly-9; SLAMF-3; CDABP0070

 

NCBI Gene ID: 4063

 

Uniprot Entry: Q9HBG7

 

Construct Details: The recombinant human SLAMF3-Fc fusion protein is expressed as a 540-amino acid protein consisting of Lys48 - Arg359 region of SLAMF3 (UniProt accession #Q9HBG7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human SLAMF3-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

KDSAPTVVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISN

LTLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTP

REPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVT

LPLALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYV

CSEASSVTSMTHVTLLIYRRSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE

VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE

PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ

QGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 75-85

 

Calculated PI: 6.31

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 78685

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized SLAMF3 binds homophilically to biotinylated SLAMF3 in a functional ELISA

 

 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Immunogenetics 11:65 (1980).   

2. J. Immunol. 125:2127 (1980).  

3. J. Immunol. 149:1636 (1992).  

4. Blood 97:3513 (2001).   

5. J Immunol. 174: 5977-86 (2005).

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0455-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.