Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human CD30 Protein, ECD (Extracellular Domain), Recombinant

Product ID: CD30 ECD (SKU#: FCL0815)

For Bulk Order: Call for price

Price:
$697.00
Size

Description

CD30/TNFRSF8 is a single-pass type I transmembrane glycoprotein of the TNF receptor superfamily (TNFRSF). The ligand for CD30 is CD30L/CD153, a member of the TNF superfamily (TNFSF8). CD30L-CD30 ligation mediates pleiotropic effects, including cell proliferation, activation, differentiation and apoptosis. CD30 is expressed in activated, but not resting, T and B cells. CD30 can regulate proliferation of lymphocytes and may also play an important role in human immunodeficiency virus (HIV) replication. As a regulator of apoptosis, CD30 protein induces cell death or proliferation, depending on the cell type, and has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. CD30 contributes to thymic negative selection by inducing the apoptotic cell death of CD4+CD8+ T cells. In B cells, CD30 ligation promotes cellular proliferation and antibody production. CD30 is overexpressed in various hematological malignancies, including Reed-Sternberg cells in Hodgkin's disease (HD), anaplastic large cell lymphoma (ALCL) and subsets of Non-Hodgkin's lymphomas (NHLs). CD30 is also found in leukocytes in patients with chronic inflammatory diseases, including lupus erythematosus, asthma, rheumatoid arthritis and atopic dermatitis.

 

CD30/TNFRSF8 is a single-pass type I transmembrane glycoprotein of the TNF receptor superfamily (TNFRSF). The ligand for CD30 is CD30L/CD153, a member of the TNF superfamily (TNFSF8). CD30L-CD30 ligation mediates pleiotropic effects, including cell proliferation, activation, differentiation and apoptosis. CD30 is expressed in activated, but not resting, T and B cells. CD30 can regulate proliferation of lymphocytes and may also play an important role in human immunodeficiency virus (HIV) replication. As a regulator of apoptosis, CD30 protein induces cell death or proliferation, depending on the cell type, and has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. CD30 contributes to thymic negative selection by inducing the apoptotic cell death of CD4+CD8+ T cells. In B cells, CD30 ligation promotes cellular proliferation and antibody production. CD30 is overexpressed in various hematological malignancies, including Reed-Sternberg cells in Hodgkin's disease (HD), anaplastic large cell lymphoma (ALCL) and subsets of Non-Hodgkin's lymphomas (NHLs). CD30 is also found in leukocytes in patients with chronic inflammatory diseases, including lupus erythematosus, asthma, rheumatoid arthritis and atopic dermatitis.

 

Product Details

 

Gene Symbol: CD30; Ki-1; TNFRSF8;  D1S166E

 

NCBI Gene ID: 943

 

Uniprot Entry: P28908

 

Construct Details: The recombinant human CD30 ECD is expressed as a 368 amino acid protein consisting of Phe19 - Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal His-tag. It contains 2 potential sites for N-linked glycosylation.

 

Source: Human cells stably expressing human CD30 ECD and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVT

CSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASP

GVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPS

SDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICA

TSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDS

QASKTLPIPTSAPVALSSTGHHHHHHHH

 

M.W.: Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 70-80

 

Calculated PI: 6.13

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  25045

 

Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies (SKU#MAB1173, #MAB1174, #MAB1176) with high affinity. Blocks CD30 Ligand­-induced IL­6 secretion by human Hodgkin’s lymphoma cells 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Cell 68:421 (1992).  

2. J. Immunol. 156:1387 (1996). 

3. Proc. Natl. Acad. Sci. 93 (24): 14053 (1996).

4. J. Biol. Chem. 271 (22): 12852 (1996).

5. Immunology 118:143 (2006).  

 



 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0815-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class 1-Pass Type I Transmembrane
Gene Synonym CD30; Ki-1; TNFRSF8; D1S166E
Gene Family TNF Receptor (TNFR) Superfamily
Research Area Cancer
"A" - "Z" List
C
Pathway/Disease Immune Response
Species
Human
CD Antigen CD30

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services