The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death.  The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal.  Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. ACVR2A (Activin receptor type-2A), also known as ACVR2 and ACTRIIA, is a type II receptors for Activins and Inhibins as well as several other members of the TGFβ superfamily proteins. Following the binding to dimeric Activin ligands, ACVRIIA then associates with a type I receptor to initiate signal transduction. Human, mouse and rat ACVRIIA share greater than 98% amino acid sequence homology. Recombinant soluble ACVRIIA bind activin with high affinity, and are potent activin antagonists. ACVR2A may function as a tumor suppressor that is frequently mutated in microsatellite-unstable colon cancers.  Inactivation of ACVR2A is also a common event in prostate cancer cells.  ACVR2A may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality.

The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death.  The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal.  Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. ACVR2A (Activin receptor type-2A), also known as ACVR2 and ACTRIIA, is a type II receptors for Activins and Inhibins as well as several other members of the TGFβ superfamily proteins. Following the binding to dimeric Activin ligands, ACVRIIA then associates with a type I receptor to initiate signal transduction. Human, mouse and rat ACVRIIA share greater than 98% amino acid sequence homology. Recombinant soluble ACVRIIA bind activin with high affinity, and are potent activin antagonists. ACVR2A may function as a tumor suppressor that is frequently mutated in microsatellite-unstable colon cancers.  Inactivation of ACVR2A is also a common event in prostate cancer cells.  ACVR2A may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality.

 

Product Details

 

Gene Symbol: ACVR2A; ACVR2; ACTRII; ActR-II; ACTRIIA; ActR-IIA; ACVRIIA; ACVR-IIA

 

NCBI Gene ID: 92

 

Uniprot Entry: P27037

 

Construct Details: The recombinant human ACVR2A-Fc fusion protein is expressed as a 344 amino acid protein consisting of Ala20 - Pro135 region of ACVR2A (UniProt accession #P27037) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition (see the gel image above, labeled as "DTT: -")

 

Source: Human cells stably expressing human ACVR2A-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS

IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEME

VTQPTSNPVTPKPPSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT

PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT

VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK

LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

 

M.W.: Calculated molecular mass (kDa): 39.0; Estimated by SDS-PAGE under reducing condition (kDa): ~55

 

Calculated PI: 5.97

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  58870

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "DTT: +")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized ACVR2A binds Activin or Inhibin in a functional ELISA.  Neutralize Activin-induced inhibition of MPC11 cell proliferation and hemoglobin expression in K562 human chronic myelogenous leukemia cells.

 

 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Nature 401:480 (1999). 

2. J. Biol. Chem. 274:584 (1999). 

3. Nature 404:411 (2000). 

4. Proc. Natl. Acad. Sci. 100:5193 (2003). 

5. Cytokine Growth Factor Rev. 17:157 (2006). 

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0149B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.