Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human IL1R1 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Product ID: IL1R1-Fc-Biot (SKU#: FCL1318B)

For Bulk Order: Call for price

Price:
$548.00
Size

Description

IL1R1 (interleukin 1 receptor, type I), also known as CD121a, is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin 1 receptor (IL1R) family. The IL1R family comprises at least 10 members, which typically contain 3 immunoglobulin (Ig)-like domains in the extracellular region. Most members also have an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. There are two distinct types of receptors for the pleiotropic cytokines IL1α and IL1β: the type I (IL1R1) is an 80 kDa transmembrane protein expressed predominantly in T cells, fibroblasts, and endothelial cells and mediates all the known IL-1 biological functions while the type II (IL1R2) is a 68 kDa transmembrane protein with a short cytoplamic domain and serves as a decoy receptor for IL1. Both receptors are members of the immunoglobulin superfamily (IgSF). However the two receptors do not heterodimerize into a receptor complex. IL1R1 acts as a receptor for both IL-1α and IL-1β through the association with the co-receptor IL1RAP (interleukin 1 receptor antagonist protein). IL1R1 and IL1RAP together form a high affinity IL-1 receptor complex, which mediates IL-1-dependent activation of NF-κB, MAPK and other signaling pathways. IL-1R1 signaling involves the recruitment of adapter molecules, such as MYD88 and IRAK1/IRAK2, via the respective TIR domains. IL1R1 is an important mediator involved in many cytokine induced immune and inflammatory responses. Recombinant soluble form of IL1R1 has been shown to be a potent antagonist of IL1 action.   

 

IL1R1 (interleukin 1 receptor, type I), also known as CD121a, is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin 1 receptor (IL1R) family. The IL1R family comprises at least 10 members, which typically contain 3 immunoglobulin (Ig)-like domains in the extracellular region. Most members also have an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. There are two distinct types of receptors for the pleiotropic cytokines IL1α and IL1β: the type I (IL1R1) is an 80 kDa transmembrane protein expressed predominantly in T cells, fibroblasts, and endothelial cells and mediates all the known IL-1 biological functions while the type II (IL1R2) is a 68 kDa transmembrane protein with a short cytoplamic domain and serves as a decoy receptor for IL1. Both receptors are members of the immunoglobulin superfamily (IgSF). However the two receptors do not heterodimerize into a receptor complex. IL1R1 acts as a receptor for both IL-1α and IL-1β through the association with the co-receptor IL1RAP (interleukin 1 receptor antagonist protein). IL1R1 and IL1RAP together form a high affinity IL-1 receptor complex, which mediates IL-1-dependent activation of NF-κB, MAPK and other signaling pathways. IL-1R1 signaling involves the recruitment of adapter molecules, such as MYD88 and IRAK1/IRAK2, via the respective TIR domains. IL1R1 is an important mediator involved in many cytokine induced immune and inflammatory responses. Recombinant soluble form of IL1R1 has been shown to be a potent antagonist of IL1 action.   

 

Product Details

 

Gene Symbol: IL1R1; CD121a; P80; IL1R; IL1RA; IL1RT1; D2S1473; IL-1R-α; IL-1R-1; IL-1RT-1; IL-1R1

 

NCBI Gene ID: 3554

 

Uniprot Entry: P14778

 

Construct Details: The recombinant human IL1R1 ECD is expressed as a 557 amino acid protein consisting of Leu18 ­Lys336 region of IL1R1 (UniProt accession #P14778) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human RSPO1-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAK

VEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPK

LQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPV

IVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLN

ISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKSTTENLYFQGSTGTHTCPPCPAPELLGGPSV

FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH

QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE

WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 63.4; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).

 

Calculated PI: 6.50

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  90730

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Interacts with human IL1α and IL1β, and blocks IL1-dependent signaling activity with a typical ED50 of 0.3 - 0.8 µg/ml

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Biol. Chem. 270:13757 (1995).  

2. J. Biol. Chem. 272 : 29167-73 (1997).

3. Proc. Natl. Acad. Sci. 94: 12829-32 (1997).

4. Nature. 386:190-194 (1997).

5. Nature. 386:194-200 (1997).



 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1318B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class 1-Pass Type I Transmembrane
Gene Synonym CD121a; P80; IL1R; IL1RA; IL1RT1; D2S1473; IL-1R-α; IL-1R-1; IL-1RT-1; IL-1R1
Gene Family Ig Superfamily; IL1 Receptor Family
Research Area Immunology
"A" - "Z" List
I
Pathway/Disease IL1R/TLR Signaling Pathway
Species
Human
CD Antigen CD121a

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services