SLAMF5 (signaling lymphocytic activation molecule family member5), also known as Ly9B and CD84, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF5 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF5 exhibits extensive, cell type­specific glycosylation and homophilic binding that is mediated by its Ig­like V-type domain. The hemophilic interaction induces tyrosine phosphorylation in the cytoplasmic ITSMs, which in turn recruit the signaling adaptor molecules and activates downstream events. SLAMF5 is widely expressed among hematopoietic cells including hematopoietic stem cells, myeloid cells, platelets, megakaryocytes, and lymphocytes. SLAMF5 signaling modulates both adaptive and innate immune responses. It inhibits mast cell activation but enhances platelet activation, macrophage activation, T cell proliferation and IFN­γ production as well as the interactions between T cells and B cells for germinal center formation. 

SLAMF5 (signaling lymphocytic activation molecule family member5), also known as Ly9B and CD84, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF5 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF5 exhibits extensive, cell type­specific glycosylation and homophilic binding that is mediated by its Ig­like V-type domain. The hemophilic interaction induces tyrosine phosphorylation in the cytoplasmic ITSMs, which in turn recruit the signaling adaptor molecules and activates downstream events. SLAMF5 is widely expressed among hematopoietic cells including hematopoietic stem cells, myeloid cells, platelets, megakaryocytes, and lymphocytes. SLAMF5 signaling modulates both adaptive and innate immune responses. It inhibits mast cell activation but enhances platelet activation, macrophage activation, T cell proliferation and IFN­γ production as well as the interactions between T cells and B cells for germinal center formation. 

 

Product Details

 

Gene Symbol: SLAMF5; SLAMF-5; CD84; LY9B; Hly9-beta; hCD84; mCD84; SLAMF-5; MAX.3

 

NCBI Gene ID: 8832

 

Uniprot Entry: Q9UIB8

 

Construct Details: The recombinant human SLAMF5-Fc fusion protein is expressed as a 431-amino acid protein consisting of Lys22 - Gly225 region of SLAMF5 (UniProt accession #Q9UIB8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human SLAMF5-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVIS

DLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGE

EGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGSTGTHTCPPCPAPELLGGPSVFLF

PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY

KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP

PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75

 

Calculated PI: 6.04

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 61935

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized SLAMF5 interacts homophilically with SLAMF5 in a functional ELISA and enhances the proliferation of PHA-stimulated T cells in the presence of anti­-CD3e antibody 

 

 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Blood, 90: 2398-2405 (1997).

2. J. Immunol. 167:3668 (2000).  

3. J. Immunol. 167: 3668-3676 (2001)..

4. Proc. Natl. Acad. Sci. 104: 10583-10588 (2007).

5. Annu. Rev. Immunol.  29:665 (2011). 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0428B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.