SLAMF7 (signaling lymphocytic activation molecule family member 7), also known as CS1, CRACC and CD319, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF7 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells. It interacts homophilically through its Ig-like V type domain to induce NK, CTL, and B cell activation. SLAMF7 may play a role in the regulation of B cell proliferation during immune responses. SLAMF7 is also implicated in the activation of NK cell-mediated cytotoxicity. SLAMF7 can exert activating or inhibitory effects on immune cells dependent on the cellular context and the availability of signaling effector/adaptor proteins.

SLAMF7 (signaling lymphocytic activation molecule family member 7), also known as CS1, CRACC and CD319, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF7 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells. It interacts homophilically through its Ig-like V type domain to induce NK, CTL, and B cell activation. SLAMF7 may play a role in the regulation of B cell proliferation during immune responses. SLAMF7 is also implicated in the activation of NK cell-mediated cytotoxicity. SLAMF7 can exert activating or inhibitory effects on immune cells dependent on the cellular context and the availability of signaling effector/adaptor proteins.

 

Product Details

 

Gene Symbol: SLAMF7; SLAMF-7; CD319; 19A; CS1; CRACC; FOAP-12; UNQ576/PRO1138

 

NCBI Gene ID: 57823

 

Uniprot Entry: Q9NQ25

 

Construct Details: The recombinant human SLAMF7-Fc fusion protein is expressed as a 432-amino acid protein consisting of Ser23 - Met2250 region of SLAMF7 (UniProt accession #Q9NQ25) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

  

Source: Human cells stably expressing human SLAMF7-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKK

NDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAAN

ESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMSTGTHTCPPCPAPELLGGPSV

FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN

GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN

YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 48.0; Estimated by SDS-PAGE under reducing condition (kDa): 60-70

 

Calculated PI: 7.12

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 68465

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized SLAMF7 interacts homophilically with SLAMF7 in a functional ELISA

 

 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Immunol. 167:5517 (2001). 

2. Immunogenetics 54:394 (2002).  

3. J. Immunol. 179 (7): 4672-8 (2007).

4. Nat. Immunol. 10: 297-305 (2009).

5. Immunol. Rev. 214:22 (2006).  

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0466B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.